SuperTutor

(15)

$15/per page/Negotiable

About SuperTutor

Levels Tought:
Elementary,Middle School,High School,College,University,PHD

Expertise:
Accounting,Business & Finance See all
Accounting,Business & Finance,Economics,Engineering,HR Management,Math Hide all
Teaching Since: Apr 2017
Last Sign in: 337 Weeks Ago
Questions Answered: 12843
Tutorials Posted: 12834

Education

  • MBA, Ph.D in Management
    Harvard university
    Feb-1997 - Aug-2003

Experience

  • Professor
    Strayer University
    Jan-2007 - Present

Category > Biology Posted 03 Jul 2017 My Price 15.00

LAB 4B Post-Lab assignment

LAB 4B Post-Lab assignment
This assignment is due by 06/29/2017 Late submissions will be will be penalized
(25% deduction/day). This assignment is worth 15 points. This assignment may
not be submitted electronically. Name:
1. What is Bioinformatics?
2. Bioinformatics tools allow us to use _______________ for the retrieval of protein
and nucleic acid information.
3. Genomic data, which includes DNA, RNA, and protein sequences, are stored in
a number of databases housed by_________________
4. Multiple sequence alignment of DNA or protein sequences allows us to
determine evolutionary relationship.
True or false
5. Percent Identity can be used to indicate degree of relatedness between
multiple sequences.
True or false
ATPADWRSQSIYFLLTDRFARTDGSTTATCNTADQKYCGGTWQGIIDKLDYIQGM
GFTAIWITPVTAQLPQTTAYGDA.
6. The above stretch of letters shows the sequence of __________________ using a
one letter code for each ______________________.
7. Use the 3 letter code to rewrite the QGMGFTAIWI amino acid sequence. 8. Match the following: Set A:
1. NCBI accession number
2. PDB ID
3. amino acids in the active site of
human salivary amylase,
4. alpha helices and beta pleated sheets
are examples of
5. total 3D conformation(shape) of an
entire polypeptide chain including alpha
helices beta sheets and other loops,
turns and bends
6. the sequence of amino acids in a
polypeptide chain determines the way a
protein folds into a unique3D shape
(native conformation)
7. % identity
8. % homology 1.____
2.____
3.____
4.____ 5.
6.
7.
8. Set B:
A. retrieve amino acid sequences of
the 3 amylases used in the lab
B. view proteins 3D structure on
computer
C. aspartate (D182)/glutamate
(E248)/aspartate (D312)
D. secondary structures that are
stabilized by hydrogen bonds
E. tertiary structure
F. primary structure
G. conserved amino acids
H. can be determined by multiple
sequence alignment using Clustal
Omega ____
____
____
____ 9. Why do organisms found at low temperatures have membrane proteins with a
higher percentage of alpha helices compare to beta sheets?
10. Does enzyme activity depend only on the 3D shape of the active site? (are
amino acids outside of the active site important for optimal function of the
enzyme?) Explain
11. Homologous sequences:
A. are expected to have very similar sequences in related organisms
B. are expected to have very similar sequences in related proteins but from
unrelated or distantly related organisms
C. may have become similar to each by random mutation
D. All of these
E. None of these
12. Bioinformatics can
A. Facilitate lab based experiments
B. Can only predict results
C. Powerful means of generating new hypotheses
D. Be accessed freely by anyone with internet access
E. All of the above

Attachments:

Answers

(15)
Status NEW Posted 03 Jul 2017 12:07 AM My Price 15.00

-----------

Attachments

file 1499043541-Solutions file.docx preview (51 words )
S-----------olu-----------tio-----------ns -----------fil-----------e -----------Hel-----------lo -----------Sir-----------/Ma-----------dam----------- T-----------han-----------k y-----------ou -----------for----------- yo-----------ur -----------int-----------ere-----------st -----------and----------- bu-----------yin-----------g m-----------y p-----------ost-----------ed -----------sol-----------uti-----------on.----------- Pl-----------eas-----------e p-----------ing----------- me----------- on----------- ch-----------at -----------I a-----------m o-----------nli-----------ne -----------or -----------inb-----------ox -----------me -----------a m-----------ess-----------age----------- I -----------wil-----------l b-----------e q-----------uic-----------kly----------- on-----------lin-----------e a-----------nd -----------giv-----------e y-----------ou -----------exa-----------ct -----------fil-----------e a-----------nd -----------the----------- sa-----------me -----------fil-----------e i-----------s a-----------lso----------- se-----------nt -----------to -----------you-----------r e-----------mai-----------l t-----------hat----------- is----------- re-----------gis-----------ter-----------ed -----------onÂ----------- th-----------is -----------web-----------sit-----------e -----------Tha-----------nk -----------you----------- -----------
Not Rated(0)